Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat ST14/Matriptase protein (His tag)
PDER100225-01 20 µg

Recombinant Rat ST14/Matriptase protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat ST14/Matriptase protein (His tag)
PDER100225-02 100 µg

Recombinant Rat ST14/Matriptase protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat ST14/Matriptase protein (His tag)
PDER100225-03 500 µg

Recombinant Rat ST14/Matriptase protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat ST14/Matriptase protein (His tag)
PDER100225-04 1 mg

Recombinant Rat ST14/Matriptase protein (His tag)

Sign In for Pricing
View Details
Choline Chloride
TRC-C432650-5G 5 g

Choline Chloride

Sign In for Pricing
View Details
FITC Conjugated Human CD4 Recombinant Mouse Monoclonal Antibody [PSH04-93]
HA600119F 100 µL

FITC Conjugated Human CD4 Recombinant Mouse Monoclonal Antibody [PSH04-93]

Sign In for Pricing
View Details