Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFRAL Antibody - N-terminal region
MBS3217822-01 0.1 mL

GFRAL Antibody - N-terminal region

Sign In for Pricing
View Details
GFRAL Antibody - N-terminal region
MBS3217822-02 5x 0.1 mL

GFRAL Antibody - N-terminal region

Sign In for Pricing
View Details
INSM2 (Insulinoma-associated Protein 2, Zinc Finger Protein IA-6, IA6, Nbla106)
146524 100 µg

INSM2 (Insulinoma-associated Protein 2, Zinc Finger Protein IA-6, IA6, Nbla106)

Sign In for Pricing
View Details
Tspo 3'UTR Lenti-reporter-Luc Vector
48603084 1.0 µg

Tspo 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit anti-BAIAP2L2 Antibody
DL92439A-01 50 µL

Rabbit anti-BAIAP2L2 Antibody

Sign In for Pricing
View Details
Rabbit anti-BAIAP2L2 Antibody
DL92439A-02 100 µL

Rabbit anti-BAIAP2L2 Antibody

Sign In for Pricing
View Details