Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Malignant T-cell-amplified sequence 2 (MCTS2)

This Recombinant Human Malignant T-cell-amplified sequence 2 (MCTS2) spans the amino acid sequence from region 1-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Malignant T-cell-amplified sequence 2 MCTS2

UniProt

A0A3B3IRV3

Expression Region

1-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFKKFDEKESVSNCIQLKTSVIKGIKSQLVEQFPGIEPWLNQIMPKKDPVKIVRCHEHTEILTVSGELLFFRQRKGPFCPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAVTAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCR-BluntII-TOPO-KCND2 Plasmid
PVT30541 2 µg

pCR-BluntII-TOPO-KCND2 Plasmid

Sign In for Pricing
View Details
SAMM50 Recombinant Antibody, Cy5 Conjugated
bsm-62522R-Cy5 100 µL

SAMM50 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Human Interleukin-5/IL-5 Protein (His Tag)
PKSH032653-01 10 µg

Recombinant Human Interleukin-5/IL-5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Interleukin-5/IL-5 Protein (His Tag)
PKSH032653-02 50 µg

Recombinant Human Interleukin-5/IL-5 Protein (His Tag)

Sign In for Pricing
View Details
AHA1 Antibody: ATTO 488
SPC-183D-A488 100 µL

AHA1 Antibody: ATTO 488

Sign In for Pricing
View Details
Anti-NARG1/NAA15 Antibody Picoband®, APC Conjugate
A05636-3-APC 100 µg/Vial

Anti-NARG1/NAA15 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details