Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSGL-1 Polyclonal Antibody
E20-75572 100 µg

PSGL-1 Polyclonal Antibody

Sign In for Pricing
View Details
VP16 (1-21) PE
sc-7545 PE 200 µg/mL

VP16 (1-21) PE

Sign In for Pricing
View Details
Anti-p53 (Phospho-S376) TP53 Antibody
A00001S376 100 µL

Anti-p53 (Phospho-S376) TP53 Antibody

Sign In for Pricing
View Details
Recombinant Mouse ACSL3 Protein, His (Fc)-Avi-tagged
ACSL3-273M 50 µg

Recombinant Mouse ACSL3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Interferon gamma (IFN-gamma)
052077 100 µg

Interferon gamma (IFN-gamma)

Sign In for Pricing
View Details
Anti-Adenylate kinase 4 Rabbit Monoclonal Antibody
MBS1757749-01 0.03 mL

Anti-Adenylate kinase 4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details