Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lgr5/GPR49 Alexa Fluor 750 Antibody (Clone 707042)
FAB8078S-100UG 100 µg

Human Lgr5/GPR49 Alexa Fluor 750 Antibody (Clone 707042)

Sign In for Pricing
View Details
CRISP3 (NM_001190986) Human Tagged ORF Clone Lentiviral Particle
RC231112L3V 200 µL

CRISP3 (NM_001190986) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CUBN Recombinant Protein
OPCD02554-50UG 50 µg

CUBN Recombinant Protein

Sign In for Pricing
View Details
(S) - (-) -1- (pentafluoro- phenyl) ethanol
CSB-DT4890 1 g

(S) - (-) -1- (pentafluoro- phenyl) ethanol

Sign In for Pricing
View Details
4933417A18Rik CRISPR Activation Plasmid (m2)
sc-426181-ACT-2 20 µg

4933417A18Rik CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT
E1086Mo-01 48 Well

Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT

Sign In for Pricing
View Details