Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CEBPZOS (CEBOS), partial

This Recombinant Human Protein CEBPZOS (CEBOS), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CEBPZOS; CEBPZ antisense RNA 1; CEBPZ opposite strand; CEBPZOS CEBPZ-AS1

UniProt

A8MTT3

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQKTWLNSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD35 Antibody (CR1/8674R) [PE]
NBP3-21125PE 0.1 mL

Rabbit Monoclonal CD35 Antibody (CR1/8674R) [PE]

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) Human shRNA Plasmid Kit (Locus ID 54474)
TR303633 1 Kit

Cytokeratin 20 (KRT20) Human shRNA Plasmid Kit (Locus ID 54474)

Sign In for Pricing
View Details
LRRN3 CRISPR Activation Plasmid (m2)
sc-421473-ACT-2 20 µg

LRRN3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Lentiviral human JTB shRNA (UAS) - Lentiviral human JTB shRNA (UAS) (25)
GTR15286649 1 Vial

Lentiviral human JTB shRNA (UAS) - Lentiviral human JTB shRNA (UAS) (25)

Sign In for Pricing
View Details
Streptococcus agalactiae (NCTC® derived CultiControl)
70046 1 Vial

Streptococcus agalactiae (NCTC® derived CultiControl)

Sign In for Pricing
View Details
MAT2A Antibody
E98436 100 µL

MAT2A Antibody

Sign In for Pricing
View Details