Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UBAP1-MVB12-associated (UMAD1)

This Recombinant Human UBAP1-MVB12-associated (UMAD1) spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBAP1-MVB12-associated; UMA-domain containing protein 1; RPA3 antisense RNA 1; RPA3 opposite strand; UMAD1 RPA3-AS1 RPA3OS

UniProt

C9J7I0

Expression Region

1-137

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Speedy protein C (SPDYC) (NM_001008778) Human Over-expression Lysate
LS387778-20ug 20 µg

Speedy protein C (SPDYC) (NM_001008778) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NT5E (5'-Nucleotidase, Ecto) ELISA Kit
ELK3395-01 48 Tests

Human NT5E (5'-Nucleotidase, Ecto) ELISA Kit

Sign In for Pricing
View Details
Human NT5E (5'-Nucleotidase, Ecto) ELISA Kit
ELK3395-02 96 Tests

Human NT5E (5'-Nucleotidase, Ecto) ELISA Kit

Sign In for Pricing
View Details
Human NT5E (5'-Nucleotidase, Ecto) ELISA Kit
ELK3395-03 5x 96 Tests

Human NT5E (5'-Nucleotidase, Ecto) ELISA Kit

Sign In for Pricing
View Details
NK1.1 antibody (biotin)
MBS832767-01 0.05 mg

NK1.1 antibody (biotin)

Sign In for Pricing
View Details
NK1.1 antibody (biotin)
MBS832767-02 0.1 mg

NK1.1 antibody (biotin)

Sign In for Pricing
View Details