Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative serine protease 46 (PRS46)

This Recombinant Human Putative serine protease 46 (PRS46) spans the amino acid sequence from region 1-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative serine protease 46; EC 3.4.21.-; Serine protease 46 pseudogene; PRSS46P PRSS46

UniProt

E5RG02

Expression Region

1-174

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (3-Bromophenyl) -8-methylimidazo[1,2-a]pyridine
OR1093648 250 mg

2- (3-Bromophenyl) -8-methylimidazo[1,2-a]pyridine

Sign In for Pricing
View Details
MRT18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV733847 1.0 µg DNA

MRT18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TRESMCR sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2459605 3x 1.0 µg

TRESMCR sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-Salmonella typhimurium Antibody
orb1148098 200 µg

Anti-Salmonella typhimurium Antibody

Sign In for Pricing
View Details
LINC00471 Human Gene Knockout Kit (CRISPR)
KN407309 1 Kit

LINC00471 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNAB1/Kv beta 1 Polyclonal Antibody, PE Conjugated
bs-8691R-PE 100 µL

KCNAB1/Kv beta 1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details