Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B11 (NPB11), partial

This Recombinant Human Nuclear pore complex-interacting protein family member B11 (NPB11), partial spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B11 NPIPB11

UniProt

E5RHQ5

Expression Region

1-62

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr383-set siRNA/shRNA/RNAi Lentivector (Rat)
34359096 4x 500 ng

Olr383-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Pirh2 Antibody
MBS9435298-01 0.05 mL

Pirh2 Antibody

Sign In for Pricing
View Details
Pirh2 Antibody
MBS9435298-02 0.1 mL

Pirh2 Antibody

Sign In for Pricing
View Details
Pirh2 Antibody
MBS9435298-03 5x 0.1 mL

Pirh2 Antibody

Sign In for Pricing
View Details
KLHL6 Protein Vector (Rat) (pPM-C-HA)
25805026 500 ng

KLHL6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
C17orf13 AAV siRNA Pooled Vector
53646161 1.0 µg

C17orf13 AAV siRNA Pooled Vector

Sign In for Pricing
View Details