Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B12 (NPB12), partial

This Recombinant Human Nuclear pore complex-interacting protein family member B12 (NPB12), partial spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B12 NPIPB12

UniProt

F8W0I5

Expression Region

1-72

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLHVIIAFPTSYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF5 Protein Lysate (Mouse) with C-HA Tag
14253035 100 µg

C1QTNF5 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
SCAX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV747941 1.0 µg DNA

SCAX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mdm2 Mouse shRNA Plasmid (Locus ID 17246)
TR501324 1 Kit

Mdm2 Mouse shRNA Plasmid (Locus ID 17246)

Sign In for Pricing
View Details
NGRN, CT (NGRN, FI58G, Neugrin, Mesenchymal stem cell protein DSC92, Neurite outgrowth-associated protein, Spinal cord-derived protein FI58G) (Azide free) (HRP) discontinued
038957-HRP 200 µL

NGRN, CT (NGRN, FI58G, Neugrin, Mesenchymal stem cell protein DSC92, Neurite outgrowth-associated protein, Spinal cord-derived protein FI58G) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
HKR1 Protein Vector (Human) (pPB-N-His)
PV019770 500 ng

HKR1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
SERPINB3 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62447R-BF680-01 20 µL

SERPINB3 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details