Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM72C (FA72C)

This Recombinant Human Protein FAM72C (FA72C) spans the amino acid sequence from region 1-149. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM72C FAM72C

UniProt

H0Y354

Expression Region

1-149

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVVYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVLNISAEECIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (Propan-2-yl) pyrrolidin-3-one
ICA03928 2.5 g

1- (Propan-2-yl) pyrrolidin-3-one

Sign In for Pricing
View Details
Aldh1l1 Mouse qPCR Template Standard (NM_027406)
MK203504 1 Kit

Aldh1l1 Mouse qPCR Template Standard (NM_027406)

Sign In for Pricing
View Details
6-Nitro-1,2-benzisothiazolin-3-one-1,1-dioxide
sc-357166 1 g

6-Nitro-1,2-benzisothiazolin-3-one-1,1-dioxide

Sign In for Pricing
View Details
P27 Analogue CP2
orb3142506-01 50 mg

P27 Analogue CP2

Sign In for Pricing
View Details
P27 Analogue CP2
orb3142506-02 10 mg

P27 Analogue CP2

Sign In for Pricing
View Details
PITRM1 Rabbit pAb (APR28152N)
APR28152N-01 50 µL

PITRM1 Rabbit pAb (APR28152N)

Sign In for Pricing
View Details