Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small leucine-rich protein 1 (SMLR1), partial

This Recombinant Human Small leucine-rich protein 1 (SMLR1), partial spans the amino acid sequence from region 74-107. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small leucine-rich protein 1 SMLR1

UniProt

H3BR10

Expression Region

74-107

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab2 (RAB2A) Human Gene Knockout Kit (CRISPR)
KN400433 1 Kit

Rab2 (RAB2A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TP53I3 Polyclonal Conjugated Antibody
C30972 100 µL

TP53I3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Posaconazole Impurity 129
RM-P190429-01 10 mg

Posaconazole Impurity 129

Sign In for Pricing
View Details
Posaconazole Impurity 129
RM-P190429-02 25 mg

Posaconazole Impurity 129

Sign In for Pricing
View Details
Posaconazole Impurity 129
RM-P190429-03 50 mg

Posaconazole Impurity 129

Sign In for Pricing
View Details
Posaconazole Impurity 129
RM-P190429-04 100 mg

Posaconazole Impurity 129

Sign In for Pricing
View Details