Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFE2L1 Rabbit Polyclonal Antibody (BF405)
orb2468774 100 µL

NFE2L1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
MYO7A Rabbit Polyclonal Antibody
orb2953566-01 50 µg

MYO7A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO7A Rabbit Polyclonal Antibody
orb2953566-02 100 µg

MYO7A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD9 Rabbit Polyclonal Antibody (APC)
orb2618147 100 µg

CD9 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
40692114 3x 1.0 µg

Rp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Ramp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3348808 1.0 µg DNA

Ramp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details