Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk Anti-Human CD166 (3A6) Antibody
ICH1188-5mg 5 mg

Bulk Anti-Human CD166 (3A6) Antibody

Sign In for Pricing
View Details
AGFG1 (NM_001135189) Human Over-expression Lysate
LC427583 20 µg

AGFG1 (NM_001135189) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS642431 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
CD8 (C8/144B), CF680 conjugate, 0.1mg/mL
BNC800749-100 1x 100 µL

CD8 (C8/144B), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL33 Mouse Monoclonal Antibody [Clone ID: 4E9]
AM09020PU-S 50 µL

IL33 Mouse Monoclonal Antibody [Clone ID: 4E9]

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3309), CF647 conjugate, 0.1mg/mL
BNC473309-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3309), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details