Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lactoferrin (LTF) (NM_002343) Human Over-expression Lysate
LS004057-100ug 100 µg

Lactoferrin (LTF) (NM_002343) Human Over-expression Lysate

Sign In for Pricing
View Details
Odf2 (NM_001177661) Mouse Tagged Lenti ORF Clone
MR225492L4 10 µg

Odf2 (NM_001177661) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SEC14L4 Protein Vector (Rat) (pPM-C-HA)
43289026 500 ng

SEC14L4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse IAPP Matched Antibody Pair Set [ABP-S-02817]
ABP-S-02817 5 Plates

Mouse IAPP Matched Antibody Pair Set [ABP-S-02817]

Sign In for Pricing
View Details
RN7SL8P ORF Vector (Human) (pORF)
ORF029521 1.0 µg DNA

RN7SL8P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IL1 beta Rabbit monoclonal antibody
BS40357 50ul

IL1 beta Rabbit monoclonal antibody

Sign In for Pricing
View Details