Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich protein 23D2 (P23D2)

This Recombinant Human Proline-rich protein 23D2 (P23D2) spans the amino acid sequence from region 1-279. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proline-rich protein 23D2 PRR23D2

UniProt

P0DMB1

Expression Region

1-279

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLNSYQSLELPQNQQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPEHVLRSEDGLQSPVQIQYIIPSVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQPLMIPQANHMAGISPSFLVTPLCIPRCRAAFPQCYPLPPTPSPVGRPRPADSSFSLHGMELLCTSSLRPMPPSPSPGPQVYHRVHHRPPSRARRCLFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR-FLIVO In vivo Poly Caspase Assay
MBS258408-01 6 Tests

SR-FLIVO In vivo Poly Caspase Assay

Sign In for Pricing
View Details
SR-FLIVO In vivo Poly Caspase Assay
MBS258408-02 24 Tests

SR-FLIVO In vivo Poly Caspase Assay

Sign In for Pricing
View Details
SR-FLIVO In vivo Poly Caspase Assay
MBS258408-03 5x 24 Tests

SR-FLIVO In vivo Poly Caspase Assay

Sign In for Pricing
View Details
RhoGAP (ARHGAP5) Rabbit Polyclonal Antibody
TA360019 100 µL

RhoGAP (ARHGAP5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFPQ Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61746R-BF405-TR 20 µL

SFPQ Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
KIAA0776 Protein Vector (Human) (pPM-C-HA)
25564021 500 ng

KIAA0776 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details