Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial

This Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial spans the amino acid sequence from region 57-153. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative transmembrane protein INAFM2; InaF-motif-containing protein 2; Osteogenesis up-regulated transcript 1; INAFM2 LINC00984 OGU1

UniProt

P0DMQ5

Expression Region

57-153

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YSLIWQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPDEDEEETAAAPGSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galpha t1 (Guanine Nucleotide-Binding Protein G (t) Subunit alpha-1, Transducin alpha-1 Chain, GNAT1, GNATR, Transducin alpha-1, Transducin alpha1, Galphat1, Galpha-t1) discontinued
222860-01 50 µL

Galpha t1 (Guanine Nucleotide-Binding Protein G (t) Subunit alpha-1, Transducin alpha-1 Chain, GNAT1, GNATR, Transducin alpha-1, Transducin alpha1, Galphat1, Galpha-t1) discontinued

Sign In for Pricing
View Details
Galpha t1 (Guanine Nucleotide-Binding Protein G (t) Subunit alpha-1, Transducin alpha-1 Chain, GNAT1, GNATR, Transducin alpha-1, Transducin alpha1, Galphat1, Galpha-t1) discontinued
222860-02 100 µL

Galpha t1 (Guanine Nucleotide-Binding Protein G (t) Subunit alpha-1, Transducin alpha-1 Chain, GNAT1, GNATR, Transducin alpha-1, Transducin alpha1, Galphat1, Galpha-t1) discontinued

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Metal tolerance protein 1 (MTP1)
MBS7022489-01 0.02 mg

Recombinant Oryza sativa subsp. japonica Metal tolerance protein 1 (MTP1)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Metal tolerance protein 1 (MTP1)
MBS7022489-02 0.1 mg

Recombinant Oryza sativa subsp. japonica Metal tolerance protein 1 (MTP1)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Metal tolerance protein 1 (MTP1)
MBS7022489-03 5x 0.1 mg

Recombinant Oryza sativa subsp. japonica Metal tolerance protein 1 (MTP1)

Sign In for Pricing
View Details
Anti-Lipase Antibody
13302-1000 1mg

Anti-Lipase Antibody

Sign In for Pricing
View Details