Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial

This Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial spans the amino acid sequence from region 30-315. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1GALT1-specific chaperone 1-like protein C1GALT1C1L

UniProt

P0DN25

Expression Region

30-315

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HIRHRGQTQDHEHHHLRPPNRNDFLNTSKVILLELSKSIRVFCIIFGESEDESYWAVLKETWTKHCDKAELYDTKNDNLFNIESNDRWVQMRTAYKYVFEKYGDNYNWFFLALPTTFAVIENLKYLLFTRDASQPFYLGHTVIFGDLEYVTVEGGIVLSRELMKRLNRLLDNSETCADQSVIWKLSEDKQLAICLKYAGVHAENAEDYEGRDVFNTKPIAQLIEEALSNNPQQVVEGCCSDMAITFNGLTPQKMEVMMYGLYRLRAFGHYFNDTLVFLPPVGSEND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYLD (phospho-Ser418) rabbit pAb
E44H14394 100 µL

CYLD (phospho-Ser418) rabbit pAb

Sign In for Pricing
View Details
Recombinant Mouse Galectin-4 Protein, His, Yeast-1mg
QP9839-ye-1mg 1mg

Recombinant Mouse Galectin-4 Protein, His, Yeast-1mg

Sign In for Pricing
View Details
Recombinant Human Beta-synuclein (SNCB)
CSB-EP624090HUb1-01 20 µg

Recombinant Human Beta-synuclein (SNCB)

Sign In for Pricing
View Details
Recombinant Human Beta-synuclein (SNCB)
CSB-EP624090HUb1-02 100 µg

Recombinant Human Beta-synuclein (SNCB)

Sign In for Pricing
View Details
Recombinant Human Beta-synuclein (SNCB)
CSB-EP624090HUb1-03 1 mg

Recombinant Human Beta-synuclein (SNCB)

Sign In for Pricing
View Details
DR1 protein Rabbit Polyclonal Antibody (BF488)
orb2379816 100 µL

DR1 protein Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details