Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein MED14OS (M14OS)

This Recombinant Human Putative uncharacterized protein MED14OS (M14OS) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein MED14OS; MED14 antisense gene protein 1; MED14 opposite strand protein; MED14OS MED14-AS1

UniProt

P0DP75

Expression Region

1-135

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (136-4B5), Biotin conjugate, 0.1mg/mL
BNCB0173-500 1x 500 µL

CD45 / LCA (136-4B5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDPN (NM_006474) Human Over-expression Lysate
LC401944 20 µg

PDPN (NM_006474) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Monoacylglycerol-O-acyltransferase 2 (MOGAT2) ELISA Kit
RDR-MOGAT2-Hu-01 96 Tests

Human Monoacylglycerol-O-acyltransferase 2 (MOGAT2) ELISA Kit

Sign In for Pricing
View Details
Human Monoacylglycerol-O-acyltransferase 2 (MOGAT2) ELISA Kit
RDR-MOGAT2-Hu-02 48 Tests

Human Monoacylglycerol-O-acyltransferase 2 (MOGAT2) ELISA Kit

Sign In for Pricing
View Details
ATP7A Rabbit Polyclonal Antibody
TA371269 100 µL

ATP7A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (ID8), 0.2mg/mL
BNUB0920-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (ID8), 0.2mg/mL

Sign In for Pricing
View Details