Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 723 (ZN723)

This Recombinant Human Zinc finger protein 723 (ZN723) spans the amino acid sequence from region 1-513. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 723 ZNF723

UniProt

P0DPD5

Expression Region

1-513

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGPLTFTDVAIKFSLEEWQFLDTAQQNLYRDVMLENYRNLVFLGVGVSKPDLITCLEQGKEPWNMKRHKMVAKPPVVCSHFAQDLWPEQGIKDSFQKVILRSYGKYGHDNLQLRKGCESVDECKMHKGGYDELKQCLTTTPSKIFQCDKYVKVFHKFSSSNSQKIRHTGNNSFKCKECGKSFCMLSHLTKHERNHTRVNCYKCEECGKAFSVPSKLNNHKRIHTGEKPYKCEECGKAFNVSSSLNNHKRIHTGEKPYKCEECGKTFNMFSSLNNHKRIHTGEKPYKCKECGKAFNVFSSLNNHKRIHTGEKPYKCEECGKAFNQPSHLATHKRIHTGEKLYKCEECGKAFSQSSHITTHKRIHTGEKPYKCEECGKAFKVSVHLTTHKRIHTGEKPYKCEECGKAFNQSSALTTHKIIHTGERPYKCKQCGKGFSQSSTLTKHKIIHTKEKPYKCEECGKAFNQYSTLNKHKIIHAREKPYKCEECGKAFNKSSILNRHKIIHTKEKSQTLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gm3500 shRNA (UAS) - Lentiviral mouse Gm3500 shRNA (UAS, iRFP) (100)
GTR15234435 1 Vial

Lentiviral mouse Gm3500 shRNA (UAS) - Lentiviral mouse Gm3500 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
BNIP1 Mouse Monoclonal Antibody [Clone ID: OTI3E10]
TA802192 100 µL

BNIP1 Mouse Monoclonal Antibody [Clone ID: OTI3E10]

Sign In for Pricing
View Details
PAIP2 Polyclonal Antibody
A67138-050 50 µL

PAIP2 Polyclonal Antibody

Sign In for Pricing
View Details
RRP4 Rabbit Polyclonal Antibody (BF750)
orb2475688 100 µL

RRP4 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Phenyl 4-Aminosalicylate
TRC-P309020-2.5G 2.5 g

Phenyl 4-Aminosalicylate

Sign In for Pricing
View Details
GPS2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-15395R-PerCP-Cy5.5 100 µL

GPS2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details