Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Centromere protein V-like protein 2 (CENL2)

This Recombinant Human Centromere protein V-like protein 2 (CENL2) spans the amino acid sequence from region 1-272. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Centromere protein V-like protein 2; Centromere protein V pseudogene 2; CENPVL2 CENPVP2

UniProt

P0DPI3

Expression Region

1-272

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGRVRNRATAQRRRRKRPGDPPAACAAIAVTGASRAQCPRVQVGVGSHAAAKRWLGRWRRKRRWRRVRKAGPRDLLPSAPTPDPPGPAPSPKDLDLGAQRERWETFRKLRGLSCEGAAKVLLDTFEYPGLVHHTGGCHCGAVRFAVWAPADLRVVDCSCRLCRKKQHRHFLVPASRFTLLQGAESIVTYRSNTHPALHSFCSRCGVQSFHAAVSDPRVYGVAPHCLDEGTVRSVVIEEVGGGDPGEEAAEEHKAIHKTSSQSAPACPREQEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycoplasma TaqMan PCR Lyophilized Kits
TM33150L 100 Reactions

Mycoplasma TaqMan PCR Lyophilized Kits

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-4362-01 50 μL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-4362-02 100 µL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-4362-03 1 mL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS706981 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
OR7G1 (N-term) Rabbit Polyclonal Antibody
AP53104PU-N 400 µL

OR7G1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details