Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4)

This Recombinant Human G antigen 4 (GAGE4) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKZF3 Polyclonal Antibody
E-AB-14763-01 20 µL

IKZF3 Polyclonal Antibody

Sign In for Pricing
View Details
IKZF3 Polyclonal Antibody
E-AB-14763-02 60 µL

IKZF3 Polyclonal Antibody

Sign In for Pricing
View Details
IKZF3 Polyclonal Antibody
E-AB-14763-03 120 µL

IKZF3 Polyclonal Antibody

Sign In for Pricing
View Details
IKZF3 Polyclonal Antibody
E-AB-14763-04 200 µL

IKZF3 Polyclonal Antibody

Sign In for Pricing
View Details
PTPN7 (NM_080588) Human Recombinant Protein
TP316254M 100 µg

PTPN7 (NM_080588) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-ISOC2
Y058903 100 µg

Anti-ISOC2

Sign In for Pricing
View Details