Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4)

This Recombinant Human G antigen 4 (GAGE4) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCS1 Recombinant Rabbit Monoclonal Antibody [PSH08-51]
HA722997 100 µL

HMGCS1 Recombinant Rabbit Monoclonal Antibody [PSH08-51]

Sign In for Pricing
View Details
PON1 (NM_000446) Human Over-expression Lysate
LY400156 100 µg

PON1 (NM_000446) Human Over-expression Lysate

Sign In for Pricing
View Details
(E,E)-1-Chloro-2,4-hexadiene
TRC-C368533-25MG 25 mg

(E,E)-1-Chloro-2,4-hexadiene

Sign In for Pricing
View Details
Pus7l Mouse Gene Knockout Kit (CRISPR)
KN514263 1 Kit

Pus7l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NKX2.8 (NKX28/2547), CF740 conjugate, 0.1mg/mL
BNC742547-100 1x 100 µL

NKX2.8 (NKX28/2547), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ReadiLink™ xtra Rapid iFluor® 647 Antibody Labeling Kit *BSA-Compatible*
1963-AAT 2 Labelings

ReadiLink™ xtra Rapid iFluor® 647 Antibody Labeling Kit *BSA-Compatible*

Sign In for Pricing
View Details