Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6S (LY6S)

This Recombinant Human Lymphocyte antigen 6S (LY6S) spans the amino acid sequence from region 27-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6S LY6S

UniProt

P0DTL4

Expression Region

27-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSVFGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human L3MBTL2 Pre-designed siRNA Set A
SI008511A 1 Each

Human L3MBTL2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SNX32, NT (SNX32, SNX6B, Sorting nexin-32, Sorting nexin-6B) (MaxLight 550)
MBS6349679-01 0.1 mL

SNX32, NT (SNX32, SNX6B, Sorting nexin-32, Sorting nexin-6B) (MaxLight 550)

Sign In for Pricing
View Details
SNX32, NT (SNX32, SNX6B, Sorting nexin-32, Sorting nexin-6B) (MaxLight 550)
MBS6349679-02 5x 0.1 mL

SNX32, NT (SNX32, SNX6B, Sorting nexin-32, Sorting nexin-6B) (MaxLight 550)

Sign In for Pricing
View Details
Pcid2 (NM_178708) Mouse Tagged Lenti ORF Clone
MR217027L3 10 µg

Pcid2 (NM_178708) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Gm1673 shRNA (UAS) - Lentiviral mouse Gm1673 shRNA (UAS) (25)
GTR15246101 1 Vial

Lentiviral mouse Gm1673 shRNA (UAS) - Lentiviral mouse Gm1673 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human Semaphorin 3A Recombinant Protein N-His-Flag Tag Lyophilized 50ug
IHUSEMA3ARNHISFLAGLY50UG 50 µg

Human Semaphorin 3A Recombinant Protein N-His-Flag Tag Lyophilized 50ug

Sign In for Pricing
View Details