Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6S (LY6S)

This Recombinant Human Lymphocyte antigen 6S (LY6S) spans the amino acid sequence from region 27-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6S LY6S

UniProt

P0DTL4

Expression Region

27-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSVFGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmrn2 Mouse shRNA Plasmid (Locus ID 105450)
TL511141 1 Kit

Mmrn2 Mouse shRNA Plasmid (Locus ID 105450)

Sign In for Pricing
View Details
Anti-FBXO21 Antibody Picoband® APC Conjugated
A13227-1-APC 100 µg/Vial

Anti-FBXO21 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
IBDV Polyclonal Antibody
MBS9233794-01 0.1 mL

IBDV Polyclonal Antibody

Sign In for Pricing
View Details
IBDV Polyclonal Antibody
MBS9233794-02 5x 0.1 mL

IBDV Polyclonal Antibody

Sign In for Pricing
View Details
CD48 Protein Vector (Human) (pPM-C-His)
PV008504 500 ng

CD48 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Sheep Olfactory receptor 10H2 (OR10H2) ELISA Kit
MBS7238852-01 48 Well

Sheep Olfactory receptor 10H2 (OR10H2) ELISA Kit

Sign In for Pricing
View Details