Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative chemokine-related protein B42 (CCB42)

This Recombinant Human Putative chemokine-related protein B42 (CCB42) spans the amino acid sequence from region 1-81. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative chemokine-related protein B42

UniProt

Q1T7F1

Expression Region

1-81

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPLSDWCCGICEEAPLGRAYTQTWMETGCGPHGVTALGQQELKDCLRARSGGTASSVDWIMEAARGSLNVHNCLIKFGRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf58 ORF Vector (Human) (pORF)
13704011 1.0 µg DNA

C11orf58 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Spats2 ORF Vector (Rat) (pORF)
ORF076902 1.0 µg DNA

Spats2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) ELISA Kit
EKN44278 96 Tests

Human Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) ELISA Kit

Sign In for Pricing
View Details
NPS-2143 (SB-262470) 5mg
A11140-5 5 mg

NPS-2143 (SB-262470) 5mg

Sign In for Pricing
View Details
FUT4 Mouse Monoclonal Antibody (BF405)
orb2369179 100 µL

FUT4 Mouse Monoclonal Antibody (BF405)

Sign In for Pricing
View Details
Rabbit Monoclonal XCL1/Lymphotactin Antibody (003) [DyLight 350]
NBP2-90674UV 0.1 mL

Rabbit Monoclonal XCL1/Lymphotactin Antibody (003) [DyLight 350]

Sign In for Pricing
View Details