Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAX1BP3 Human Gene Knockout Kit (CRISPR)
KN204776RB 1 Kit

TAX1BP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tide Fluor™ 3 phosphoramidite [TF3 CEP] *Superior replacement to Cy3 phosphoramidite*
2274-AAT 100 µmole

Tide Fluor™ 3 phosphoramidite [TF3 CEP] *Superior replacement to Cy3 phosphoramidite*

Sign In for Pricing
View Details
Rat Hephaestin (HEPH) ELISA Kit
RD-HEPH-Ra-01 96 Tests

Rat Hephaestin (HEPH) ELISA Kit

Sign In for Pricing
View Details
Rat Hephaestin (HEPH) ELISA Kit
RD-HEPH-Ra-02 48 Tests

Rat Hephaestin (HEPH) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse VEGFR3/FLT4 Protein (Fc Tag)
PKSM040597 100 µg

Recombinant Mouse VEGFR3/FLT4 Protein (Fc Tag)

Sign In for Pricing
View Details
Mcam Mouse Gene Knockout Kit (CRISPR)
KN309859 1 Kit

Mcam Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details