Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-160 kDa Neurofilament Medium Rabbit pAb
GB111245-50 50 μL

Anti-160 kDa Neurofilament Medium Rabbit pAb

Sign In for Pricing
View Details
Anti-TTF2 Antibody Picoband® FITC Conjugated
A04344-2-FITC 100 µg/Vial

Anti-TTF2 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Siglec-1 (B-1) Alexa Fluor® 488
sc-398109 AF488 200 µg/mL

Siglec-1 (B-1) Alexa Fluor® 488

Sign In for Pricing
View Details
SAMHD1/MOP5 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61737R-BF647-TR 20 µL

SAMHD1/MOP5 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Lentiviral human CCT3 shRNA (UAS) - Lentiviral human CCT3 shRNA (UAS, iRFP) (25)
GTR15315857 1 Vial

Lentiviral human CCT3 shRNA (UAS) - Lentiviral human CCT3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
C1orf161 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0214807 1.0 µg DNA

C1orf161 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details