Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lens epithelial cell protein LEP503 (LENEP)

This Recombinant Human Lens epithelial cell protein LEP503 (LENEP) spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lens epithelial cell protein LEP503 LENEP LEP503

UniProt

Q9Y5L5

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF4 Antibody
F44471-0.08ML 0.08 mL

TRAF4 Antibody

Sign In for Pricing
View Details
ENSA Polyclonal Antibody, Biotin Conjugated
bs-11793R-Biotin 100 µL

ENSA Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS701707 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
HIP1R Antibody (N-term)
E45R12376G-4 50 µL

HIP1R Antibody (N-term)

Sign In for Pricing
View Details
2-Aminoethanol Hydrochloride
TRC-A576798-250MG 250 mg

2-Aminoethanol Hydrochloride

Sign In for Pricing
View Details
Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Over-expression Lysate
LH03817V 100 µg

Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Over-expression Lysate

Sign In for Pricing
View Details