Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary microtubule inner protein 3 (CMIP3)

This Recombinant Human Ciliary microtubule inner protein 3 (CMIP3) spans the amino acid sequence from region 1-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ciliary microtubule inner protein 3; GUCA1A neighbor; CIMIP3 GUCA1ANB

UniProt

X6R8D5

Expression Region

1-112

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCKDSQKPSVPSHGPKTPSCKGVKAPHSSRPRAWKQDLEQSLAAAYVPVVVDSKGQNPDKLRFNFYTSQYSNSLNPFYTLQKPTCGYLYRRDTDHTRKRFDVPPANLVLWRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8- (6-Aminohexyl) -amino-GTP-ATTO-465
orb64276 120 µL

8- (6-Aminohexyl) -amino-GTP-ATTO-465

Sign In for Pricing
View Details
Ak1 (NM_001198791) Mouse Tagged ORF Clone
MR228419 10 µg

Ak1 (NM_001198791) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
pUNO1-hTLR4a-HA3x
puno1ha-htlr4a 20 µg

pUNO1-hTLR4a-HA3x

Sign In for Pricing
View Details
Rabbit Polyclonal RUNDC1 Antibody
NBP1-84103-25ul 25 µL

Rabbit Polyclonal RUNDC1 Antibody

Sign In for Pricing
View Details
CD19 (B-Lymphocyte Marker) (CD19/3117), CF568 conjugate, 0.1mg/mL
BNC683117-500 1x 500 µL

CD19 (B-Lymphocyte Marker) (CD19/3117), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIR3910-1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV768520 1.0 µg DNA

MIR3910-1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details