Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Translation machinery-associated protein 7B (TMA7B)

This Recombinant Human Translation machinery-associated protein 7B (TMA7B) spans the amino acid sequence from region 1-64. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Translation machinery-associated protein 7B TMA7B

UniProt

A0A024R1R8

Expression Region

1-64

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-4,5-dichloropyrimidine
TRC-A577135-10G 10 g

2-Amino-4,5-dichloropyrimidine

Sign In for Pricing
View Details
CXXC4 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2517741 100 µL

CXXC4 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
BOP1 Rabbit Polyclonal Antibody (PE)
orb494688 100 µL

BOP1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mini Sample Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit
E-MSEL-H0011-01 24 Tests

Mini Sample Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit
E-MSEL-H0011-02 48 Tests

Mini Sample Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit
E-MSEL-H0011-03 96 Tests

Mini Sample Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details