Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2)

This Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CCDC28A-AS1; GVQW motif-containing protein 2; CCDC28A-AS1 GVQW2

UniProt

A0A096LPI5

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISAHCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quick Step Bovine Omentin ELISA Kit
QS0262Bo-01 48 Tests

Quick Step Bovine Omentin ELISA Kit

Sign In for Pricing
View Details
Quick Step Bovine Omentin ELISA Kit
QS0262Bo-02 96 Tests

Quick Step Bovine Omentin ELISA Kit

Sign In for Pricing
View Details
GLRA2 siRNA (Rat)
MBS8203374-01 15 nmol

GLRA2 siRNA (Rat)

Sign In for Pricing
View Details
GLRA2 siRNA (Rat)
MBS8203374-02 30 nmol

GLRA2 siRNA (Rat)

Sign In for Pricing
View Details
GLRA2 siRNA (Rat)
MBS8203374-03 5x 30 nmol

GLRA2 siRNA (Rat)

Sign In for Pricing
View Details
PPA2 (NM_176866) Human Tagged ORF Clone Lentiviral Particle
RC223369L4V 200 µL

PPA2 (NM_176866) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details