Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A)

This Recombinant Human Uncharacterized protein CXorf51A (CX05A) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Factor Bb (Complement Factor B Bb Fragment, Glycine-rich beta Glycoprotein, GBG, PBF2, Properdin Factor B) (MaxLight 750) discontinued
C7850-68-ML750 100 µL

Complement Factor Bb (Complement Factor B Bb Fragment, Glycine-rich beta Glycoprotein, GBG, PBF2, Properdin Factor B) (MaxLight 750) discontinued

Sign In for Pricing
View Details
WDR38 Human Gene Knockout Kit (CRISPR)
KN421923 1 Kit

WDR38 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Paper filter disc diam.90mm fast quantitative 41 10,0um retention GVS 100 pc
FP090DFA41QANC01 100 Pieces/Case:100 Pieces/ PACKS:1 PACKS/CASE

Paper filter disc diam.90mm fast quantitative 41 10,0um retention GVS 100 pc

Sign In for Pricing
View Details
Gpr101 Mouse Gene Knockout Kit (CRISPR)
KN507179 1 Kit

Gpr101 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque MACROD1 Protein, His (Fc)-Avi-tagged
MACROD1-2437R 50 µg

Recombinant Rhesus Macaque MACROD1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
C16orf61 Rabbit Polyclonal Antibody
E28PN7945 100 µL

C16orf61 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details