Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 5 (SPRR5)

This Recombinant Human Small proline-rich protein 5 (SPRR5) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 5 SPRR5

UniProt

A0A1B0GTR4

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQKQCAPPQQCCPPPQQRCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQYCPPPQQTKQPCQPPPKCQEPCAPKCPPPQQCQTSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bim Antibody : HRP (OAPB00047-HRP)
OAPB00047-100UG-HRP 0.1 mg

Bim Antibody : HRP (OAPB00047-HRP)

Sign In for Pricing
View Details
NT5DC1 Mouse Monoclonal Antibody [Clone ID: LBI3A6]
AMM10144V 100 µL

NT5DC1 Mouse Monoclonal Antibody [Clone ID: LBI3A6]

Sign In for Pricing
View Details
Recombinant Mouse IgM Protein
EMJ93201 100 μg

Recombinant Mouse IgM Protein

Sign In for Pricing
View Details
TRAV12-2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2444304 1.0 µg DNA

TRAV12-2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Beta Amyloid [1-42] Peptide
350017 1 mg

Beta Amyloid [1-42] Peptide

Sign In for Pricing
View Details
Human I-PTH (intact Parathormone) ELISA Kit
EKE60888-01 96 Tests

Human I-PTH (intact Parathormone) ELISA Kit

Sign In for Pricing
View Details