Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53)

This Recombinant Human Testis-expressed protein 53 (TEX53) spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Periplakin, CT (PPL, Paraneoplastic Pemphigus Antigen, 195kD Cornified Envelope Precursor, AW553870, KIAA0568, MGC134872) (MaxLight 490) discontinued
040322-ML490 100 µL

Periplakin, CT (PPL, Paraneoplastic Pemphigus Antigen, 195kD Cornified Envelope Precursor, AW553870, KIAA0568, MGC134872) (MaxLight 490) discontinued

Sign In for Pricing
View Details
POLR2F Antibody (N-Term)
orb1925591-01 50 µL

POLR2F Antibody (N-Term)

Sign In for Pricing
View Details
POLR2F Antibody (N-Term)
orb1925591-02 100 µL

POLR2F Antibody (N-Term)

Sign In for Pricing
View Details
SYT8 Antibody (Center)
E45R30589G-1 100 µL

SYT8 Antibody (Center)

Sign In for Pricing
View Details
Influenza A Hemagglutinin H3N2 (HA) Antibody (HRP)
abx318886-01 20 µg

Influenza A Hemagglutinin H3N2 (HA) Antibody (HRP)

Sign In for Pricing
View Details
Influenza A Hemagglutinin H3N2 (HA) Antibody (HRP)
abx318886-02 50 µg

Influenza A Hemagglutinin H3N2 (HA) Antibody (HRP)

Sign In for Pricing
View Details