Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53)

This Recombinant Human Testis-expressed protein 53 (TEX53) spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR6 (PARD6A) (NM_001037281) Human Tagged Lenti ORF Clone
RC204843L3 10 µg

PAR6 (PARD6A) (NM_001037281) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HDAC6 Antibody
CSB-PA002915-01 50 µg

HDAC6 Antibody

Sign In for Pricing
View Details
HDAC6 Antibody
CSB-PA002915-02 100 µg

HDAC6 Antibody

Sign In for Pricing
View Details
Xrcc3 (BC043073) Mouse Tagged ORF Clone
MR202365 10 µg

Xrcc3 (BC043073) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) discontinued
C2258-91B 200 µg

CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) discontinued

Sign In for Pricing
View Details
GAPDHP36 3'UTR GFP Stable Cell Line
TU058591 1.0 mL

GAPDHP36 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details