Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CFAP97D2 (C97D2)

This Recombinant Human Uncharacterized protein CFAP97D2 (C97D2) spans the amino acid sequence from region 1-98. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CFAP97D2; CFAP97 domain-containing protein 2; CFAP97D2

UniProt

A0A1B0GU71

Expression Region

1-98

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MHGAPRLTFPCASEYLWHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNNSKHRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Histone Deacetylase 4 ELISA Kit
IHUHDAC4KT 1 Each

Human Histone Deacetylase 4 ELISA Kit

Sign In for Pricing
View Details
Chromatography Packing Adsorbents, C8,10μm, 100Å, spherical,100g/pk
13101069 200 g

Chromatography Packing Adsorbents, C8,10μm, 100Å, spherical,100g/pk

Sign In for Pricing
View Details
MIR7045 Mouse MicroRNA Expression Plasmid (MI0022894)
SC402928 10 µg

MIR7045 Mouse MicroRNA Expression Plasmid (MI0022894)

Sign In for Pricing
View Details
Anti-ADAM15 Antibody Picoband®, Carrier-free
A02593-4-carrier-free 100 µg/Vial

Anti-ADAM15 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Phospho-ERBB2 (Y1127) Antibody
E45R05254G-4 50 µL

Phospho-ERBB2 (Y1127) Antibody

Sign In for Pricing
View Details
Ext2 Mouse shRNA Plasmid (Locus ID 14043)
TR500644 1 Kit

Ext2 Mouse shRNA Plasmid (Locus ID 14043)

Sign In for Pricing
View Details