Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C17orf114 (CQ114)

This Recombinant Human Uncharacterized protein C17orf114 (CQ114) spans the amino acid sequence from region 1-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf114 C17orf114

UniProt

A0A1B0GUV1

Expression Region

1-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGLKGAWCFPWCGCRRQRGTERGAGLSPAAPPDPSPAIAPTMAEGGVPSPGPGAYFSRKARLSFRHQLHDIASANDSTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Glutathione S Transferase Alpha 3 ELISA kit
GTR10447620 96 Well

Chicken Glutathione S Transferase Alpha 3 ELISA kit

Sign In for Pricing
View Details
SEC63 (Translocation Protein SEC63 Homolog, SEC63L, DNAJC23, ERdj2, PRO2507)
133086 50 µg

SEC63 (Translocation Protein SEC63 Homolog, SEC63L, DNAJC23, ERdj2, PRO2507)

Sign In for Pricing
View Details
Mouse Monoclonal FoxP3 Antibody (376209R) [Janelia Fluor 585]
FAB8970JF585 0.1 mL

Mouse Monoclonal FoxP3 Antibody (376209R) [Janelia Fluor 585]

Sign In for Pricing
View Details
1-Octadecanesulfonyl chloride
sc-264933 5 g

1-Octadecanesulfonyl chloride

Sign In for Pricing
View Details
GRK4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV660766 1.0 µg DNA

GRK4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
APBB2 Protein Vector (Human) (pPB-His-MBP)
PV322662 500 ng

APBB2 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details