Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CHD9 neighbor protein (CHD9N)

This Recombinant Human CHD9 neighbor protein (CHD9N) spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHD9 neighbor protein CHD9NB

UniProt

A0A1B0GV96

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCHSSKSTTVAAESQKLEEEREGREPGLETGTQAADCKDAPLKDGTPEPKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Pax3 Antibody (GT2411)
NBP3-13612 100 µL

Mouse Monoclonal Pax3 Antibody (GT2411)

Sign In for Pricing
View Details
Aspartoacylase (ASPA) Rat ELISA Kit
B6961 96 Tests

Aspartoacylase (ASPA) Rat ELISA Kit

Sign In for Pricing
View Details
IL 28 Rabbit Polyclonal Antibody
TD-251354 100 µL

IL 28 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-LKB1 (Thr363) Rabbit Polyclonal Antibody (PE-Cy5)
orb894688 100 µL

Phospho-LKB1 (Thr363) Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
C6orf120 Knockout HCT116 Polyclonal Cells
ARG41521 1 Million

C6orf120 Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
APEX1 Rabbit Polyclonal Antibody (FITC)
orb2100624 100 µL

APEX1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details