Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54)

This Recombinant Human Testis-expressed protein 54 (TEX54) spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS702341 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB503132 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
3'-Azido-3'-deoxythymidine 5’-Monophosphate Sodium Salt
TRC-A825070-10MG 10 mg

3'-Azido-3'-deoxythymidine 5’-Monophosphate Sodium Salt

Sign In for Pricing
View Details
2-Hydroxyethyl 4-(tert-Butyl)benzenesulfonate
TRC-H393940-2.5G 2.5 g

2-Hydroxyethyl 4-(tert-Butyl)benzenesulfonate

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-70236-01 60 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-70236-02 120 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details