Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54)

This Recombinant Human Testis-expressed protein 54 (TEX54) spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid Hormone (PTH) (N-Terminal), CF640R conjugate, 0.1mg/mL
BNC401728-500 1x 500 µL

Parathyroid Hormone (PTH) (N-Terminal), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PYK2 Antibody
KC-6216-01 50 μL

PYK2 Antibody

Sign In for Pricing
View Details
PYK2 Antibody
KC-6216-02 100 µL

PYK2 Antibody

Sign In for Pricing
View Details
PYK2 Antibody
KC-6216-03 1 mL

PYK2 Antibody

Sign In for Pricing
View Details
FGFR1 Polyclonal Antibody
E-AB-90005-01 60 µL

FGFR1 Polyclonal Antibody

Sign In for Pricing
View Details
FGFR1 Polyclonal Antibody
E-AB-90005-02 120 µL

FGFR1 Polyclonal Antibody

Sign In for Pricing
View Details