Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54)

This Recombinant Human Testis-expressed protein 54 (TEX54) spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus Aureus SACOL1707 Protein (aa 1-228)
VAng-Cr6216-1mgEcoli 1 mg (E. coli)

Recombinant Staphylococcus Aureus SACOL1707 Protein (aa 1-228)

Sign In for Pricing
View Details
Phospho-NFKBIB (S23) Antibody
CSB-PA000560-01 50 µg

Phospho-NFKBIB (S23) Antibody

Sign In for Pricing
View Details
Phospho-NFKBIB (S23) Antibody
CSB-PA000560-02 100 µg

Phospho-NFKBIB (S23) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal RAB3IL1 Antibody (OTI1B5)
NBP2-03780 0.1 mL

Mouse Monoclonal RAB3IL1 Antibody (OTI1B5)

Sign In for Pricing
View Details
Human SCNN1a ELISA Kit
orb442094-01 48 Tests

Human SCNN1a ELISA Kit

Sign In for Pricing
View Details
Human SCNN1a ELISA Kit
orb442094-02 96 Tests

Human SCNN1a ELISA Kit

Sign In for Pricing
View Details