Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8)

This Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombospondin type-1 domain-containing protein 8 THSD8

UniProt

A0A1W2PP97

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ALVYQDYQYLGQQGEGDSWEQLRLQHLKEVEDSILGPWGKWRCLCDLGKQERSREVVGTAPGPVFMDPEKLIQLRPCRQRDCPSCKPFDCDWRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ11 Rabbit Polyclonal Antibody
AP01225PU-N 100 µg

KCNJ11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Meter™ Cell Viability Assay Kit *Red Fluorescence*
22783-AAT 200 Tests

Cell Meter™ Cell Viability Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
Milk Fat Globulin (MFG-06), CF740 conjugate, 0.1mg/mL
BNC740227-500 1x 500 µL

Milk Fat Globulin (MFG-06), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
alpha Defensin 1 (DEFA1) Rabbit Polyclonal Antibody
AP20627PU-N 100 µg

alpha Defensin 1 (DEFA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fmoc-Tyr (t-Bu) Wang Resin
H0751501326.25G 25 g

Fmoc-Tyr (t-Bu) Wang Resin

Sign In for Pricing
View Details
FAM130A2 (CSRNP3) (N-term) Rabbit Polyclonal Antibody
AP51104PU-N 400 µL

FAM130A2 (CSRNP3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details