Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 41 (SIM41), partial

This Recombinant Human Small integral membrane protein 41 (SIM41), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 41 SMIM41

UniProt

A0A2R8YCJ5

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNGSQAGAAAQAAWLSSCCNQSASPPEPPEGPRAVQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), Biotin conjugate, 0.1mg/mL
BNCB0531-100 1x 100 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XRCC3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F3]
TA804761AM 100 µL

XRCC3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F3]

Sign In for Pricing
View Details
PLK4 Human Gene Knockout Kit (CRISPR)
KN206015LP 1 Kit

PLK4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Amino-nicotinonitrile
TRC-A615030-25MG 25 mg

4-Amino-nicotinonitrile

Sign In for Pricing
View Details
SLC30A7 (NM_001144884) Human Over-expression Lysate
LC428544 20 µg

SLC30A7 (NM_001144884) Human Over-expression Lysate

Sign In for Pricing
View Details
KIAA1970 (EARS2) (NM_001083614) Human Over-expression Lysate
LY421237 100 µg

KIAA1970 (EARS2) (NM_001083614) Human Over-expression Lysate

Sign In for Pricing
View Details