Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 41 (SIM41), partial

This Recombinant Human Small integral membrane protein 41 (SIM41), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 41 SMIM41

UniProt

A0A2R8YCJ5

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNGSQAGAAAQAAWLSSCCNQSASPPEPPEGPRAVQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Car15 Mouse Gene Knockout Kit (CRISPR)
KN502531 1 Kit

Car15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Boc-piperazine-d8
TRC-B662002-250MG 250 mg

N-Boc-piperazine-d8

Sign In for Pricing
View Details
CD1 (CD1A) (NM_001763) Human Recombinant Protein
TP700275 20 µg

CD1 (CD1A) (NM_001763) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Cas9 | CRISPR-associated endonuclease 9 (polyclonal) - DyLight® 650 conjugated (40 µg)
AS16 3690-DL650 40 µg

Anti-Cas9 | CRISPR-associated endonuclease 9 (polyclonal) - DyLight® 650 conjugated (40 µg)

Sign In for Pricing
View Details
Human MIP-1α Antibody Pair Set
E-KAB-0515 50 µL & 100 µg

Human MIP-1α Antibody Pair Set

Sign In for Pricing
View Details
Human AGRN (Agrin) CLIA Kit
E-CL-H0244-01 24 Tests

Human AGRN (Agrin) CLIA Kit

Sign In for Pricing
View Details