Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP)

This Recombinant Human T-cell receptor gamma alternate reading frame protein (TARP) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell receptor gamma alternate reading frame protein; TARP; TRGC1

UniProt

A2JGV3

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQMFPPSPLFFFLQLLKQSSRRLEHTFVFLRNFSLMLLRYIGKKRRATRFWDPRRGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD42 Rabbit Polyclonal Antibody
TA344033 100 µL

ANKRD42 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Bromo-6-fluoroaniline
TRC-B684380-2G 2 g

2-Bromo-6-fluoroaniline

Sign In for Pricing
View Details
TPO (Human) OmniKine ELISA Kit
MBS9501893-01 1 Kit

TPO (Human) OmniKine ELISA Kit

Sign In for Pricing
View Details
TPO (Human) OmniKine ELISA Kit
MBS9501893-02 5x 1 Kit

TPO (Human) OmniKine ELISA Kit

Sign In for Pricing
View Details
PIAS2, CT (E3 SUMO-protein Ligase PIAS2, Protein Inhibitor of Activated STAT2, Protein Inhibitor of Activated STAT x, Msx-interacting Zinc Finger Protein, Miz1, DAB2-interacting Protein, DIP, Androgen Receptor-interacting Protein 3, ARIP3, PIAS-NY Protein, PIASX)
P4085-11B 200 µL

PIAS2, CT (E3 SUMO-protein Ligase PIAS2, Protein Inhibitor of Activated STAT2, Protein Inhibitor of Activated STAT x, Msx-interacting Zinc Finger Protein, Miz1, DAB2-interacting Protein, DIP, Androgen Receptor-interacting Protein 3, ARIP3, PIAS-NY Protein, PIASX)

Sign In for Pricing
View Details
HCMV (1F11) Monoclonal Antibody, APC Conjugated
bsm-2271M-APC 100 µL

HCMV (1F11) Monoclonal Antibody, APC Conjugated

Sign In for Pricing
View Details