Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LMO7 downstream neighbor protein (LMO7D)

This Recombinant Human LMO7 downstream neighbor protein (LMO7D) spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LMO7 downstream neighbor protein LMO7DN C13orf45

UniProt

F2Z398

Expression Region

1-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALSPRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTALYLVEEAWAEAGKMRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF647 conjugate, 0.1mg/mL
BNC472243-500 1x 500 µL

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPINT3 (NM_006652) Human Recombinant Protein
TP325005M 100 µg

SPINT3 (NM_006652) Human Recombinant Protein

Sign In for Pricing
View Details
Blood Bank Refrigerator BBBF-301
BBBF-301 1 Unit

Blood Bank Refrigerator BBBF-301

Sign In for Pricing
View Details
SARS-CoV-2 Spike NTD Protein (T95I, G142D, E154K), His Tag (MALS verified)
S1D-C52Hf-1mg 1 mg

SARS-CoV-2 Spike NTD Protein (T95I, G142D, E154K), His Tag (MALS verified)

Sign In for Pricing
View Details
ZNF 639 (ZNF639) (NM_001303425) Human Tagged ORF Clone
RG238502 10 µg

ZNF 639 (ZNF639) (NM_001303425) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human ethanolamine kinase (ETNK1) activation kit by CRISPRa
GA110759 1 Kit

Human ethanolamine kinase (ETNK1) activation kit by CRISPRa

Sign In for Pricing
View Details