Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LMO7 downstream neighbor protein (LMO7D)

This Recombinant Human LMO7 downstream neighbor protein (LMO7D) spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LMO7 downstream neighbor protein LMO7DN C13orf45

UniProt

F2Z398

Expression Region

1-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALSPRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTALYLVEEAWAEAGKMRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluor405-conjugated Monoclonal Mouse Anti-Human IgG Fc specific Secondary Antibody
AMS0219-01 200 µL

Fluor405-conjugated Monoclonal Mouse Anti-Human IgG Fc specific Secondary Antibody

Sign In for Pricing
View Details
Fluor405-conjugated Monoclonal Mouse Anti-Human IgG Fc specific Secondary Antibody
AMS0219-02 500 µL

Fluor405-conjugated Monoclonal Mouse Anti-Human IgG Fc specific Secondary Antibody

Sign In for Pricing
View Details
Goat Acti-vated protein C (APC) ELISA Kit
EIA05057Go 1 Kit

Goat Acti-vated protein C (APC) ELISA Kit

Sign In for Pricing
View Details
GNAS Polyclonal Antibody, HRP Conjugated
bs-3939R-HRP-TR 20 µL

GNAS Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Anti-DLX2 Antibody Picoband®, APC Conjugate
A03617-2-APC 100 µg/Vial

Anti-DLX2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Guinea Pig Luteinizing Hormone, LH ELISA KIT
E0106Gp-01 48 Well

Guinea Pig Luteinizing Hormone, LH ELISA KIT

Sign In for Pricing
View Details