Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein encoded by LINC01387 (CR064)

This Recombinant Human Putative uncharacterized protein encoded by LINC01387 (CR064) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein encoded by LINC01387 LINC01387 C18orf64

UniProt

J3KSC0

Expression Region

1-135

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPAPPFLGVLENPVPQWDLSILGSIRIRVSHTEVQGSGSSRSPEALRKESLEVEWTLVLLAIPPRIQPSQQDGGPPKCCDLLRAALLGRHCPLCVPAGEVFSQKRDNEQDRSEFIGQTLKLLVKRNVSLELSCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-20a-5p miRNA Inhibitor
CIH0014-01 10 nmol

Hsa-miR-20a-5p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-20a-5p miRNA Inhibitor
CIH0014-02 20 nmol

Hsa-miR-20a-5p miRNA Inhibitor

Sign In for Pricing
View Details
PHF5GP CRISPR All-in-one AAV vector set (with saCas9)(Human)
36579151 3x 1.0 µg DNA

PHF5GP CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
GNG2 Polyclonal Antibody
ANT-12381-100ug 100 µg

GNG2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Plasmodium Knowlesi PKH_072200 Protein (aa 1-184)
VAng-Wyb7816-500gEcoli 500 µg (E. coli)

Recombinant Plasmodium Knowlesi PKH_072200 Protein (aa 1-184)

Sign In for Pricing
View Details
LUZP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV659144 1.0 µg DNA

LUZP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details