Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ARL14 effector protein-like (A14EL)

This Recombinant Human ARL14 effector protein-like (A14EL) spans the amino acid sequence from region 1-152. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARL14 effector protein-like ARL14EPL

UniProt

P0DKL9

Expression Region

1-152

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNEQSEKNNSIQERHTDHSFPEKNCQIGQKQLQQIERQLKCLAFRNPGPQVADFNPETRQQKKKARMSKMNEYFSTKYKIMRKYDKSGRLICNDADLCDCLEKNCLGCFYPCPKCNSNKCGPECRCNRRWVYDAIVTESGEVISTLPFNVPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNS (3,4-Methylenedioxy-β-nitrostyrene)
C10545-50mg 50 mg

MNS (3,4-Methylenedioxy-β-nitrostyrene)

Sign In for Pricing
View Details
RGS16 (2C18) Mouse Monoclonal antibody
E28PE1765 100 µL

RGS16 (2C18) Mouse Monoclonal antibody

Sign In for Pricing
View Details
GABARAP Antibody - N-terminal region : Biotin (ARP51265_P050-Biotin)
ARP51265_P050-Biotin 100 µL

GABARAP Antibody - N-terminal region : Biotin (ARP51265_P050-Biotin)

Sign In for Pricing
View Details
TICAM2 Antibody
CSB-PA043920-01 50 μL

TICAM2 Antibody

Sign In for Pricing
View Details
TICAM2 Antibody
CSB-PA043920-02 100 µL

TICAM2 Antibody

Sign In for Pricing
View Details
PIGL Protein Vector (Rat) (pPM-C-His)
PV293977 500 ng

PIGL Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details